DPCstruct | MC22651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3HE64 | 19-181 | IYVYGQAPYTSALEGQFKGYFTIGKCDVSSITAKVRLSTLAGEPTVYVNIRWRNGSGSSSDCLGNEKFNLFVKIYSNYSSSYFYIPA… |
| A0A4S4B433 | 262-395 | ANGAGQGPGRGSMTKRNLTVGRCGVESFTVHWNLGVLLGEPTVDGGYTWQGPADCELPSTTVVLLYVRRAGEPGGWVELSPAVPRAG… |
| A0A0P0P2X2 | 449-578 | None |
| A0A4R2F6L8 | 18-157 | None |
| A0A2E9RKG1 | 14-154 | None |
| A0A556M9Q9 | 21-164 | None |
| A0A2S5A1Z7 | 1-165 | None |
| A0A7W4W2X5 | 167-317 | None |
| A0A858SQT0 | 44-227 | None |
| A0A7Y5GUM5 | 1057-1194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.