DPCstruct | MC22649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 181 ± 22 aa |
| Standard deviation of domain lengths | 22.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8QZ59 | 14-182 | SFENFLNKLKCDIDDPKIYRDFRKNILSIKKYTKNNNTVIDQNSEYFKKLIPFLDFIVNDNEKNIENDFLNTMKSFLHINNKRTLDK… |
| A0A1M3H5H4 | 45-238 | SAYERLKDKYVDFPKVERFLSAIPIKLTRTRNEPSVYNLLCDFAVFVGELINEGFPIYKPLRQHAILEANVAEKIAGLPDPLTLIQT… |
| A0A2N2XGL7 | 4-151 | None |
| A0A7U6JI28 | 262-444 | None |
| A0A1M6C924 | 3-171 | None |
| A0A3P3R0C1 | 7-210 | None |
| A0A1Y0Y2L1 | 82-239 | None |
| A0A2S1QXH2 | 47-270 | None |
| A0A7T8QNW6 | 4-187 | None |
| A0A1K1N940 | 3-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.