DPCstruct | MC22638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 189 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13569 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6VC50 | 29-191 | DDSIISNVFIKDKSATVSSKVIRYILGEYLDIKEAYRLRNADMIGNSLDSESLSEALEKVYKSWDENNKTKSILYPYCIFANNIQLD… |
| A0A849C7L4 | 13-234 | PWEREARAAVAEPTGPPKLPWLHRDQLPKVWLRNGRVLPAGAVDNLIGALALGPVSNADPHGYPGLPETLEQCDRDALADFGWALFD… |
| M6R9Z8 | 405-637 | None |
| M3GMT2 | 74-267 | None |
| A0A2X2K5Z3 | 210-376 | None |
| M6YHL5 | 2-180 | None |
| A0A7W0Q2Y9 | 565-726 | None |
| A0A1Q9UCZ0 | 167-383 | None |
| G2DXX8 | 805-994 | None |
| A0A345XSA4 | 658-827 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.