DPCstruct | MC22636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9B744 | 256-371 | LDAADAGRPAVVIRDKRRVAAVDADRLVQFLTRHHPAGVQAGADGDGWSIVLPGTPVAADGATIDEAVEEMIDVLRDYAEAWIERFR… |
| A0A849C0W5 | 25-116 | VGRLRWLLSHIISAHEPQIVRENNNWVAYLPGLPLAVEEPDFDTAVNALIEAMREYAADWQDHLHAALNHRKNVDFVQFVELSTDDQ… |
| A0A3P8LGE3 | 189-276 | None |
| A0A7W8QRQ8 | 3-83 | None |
| A0A7V6Q3P0 | 20-136 | None |
| A0A1F8LB21 | 9-127 | None |
| A0A0K2RDK1 | 6-90 | None |
| A0A4Y8KDF7 | 20-122 | None |
| A0A378XB15 | 4-106 | None |
| A0A1X6ME58 | 13-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.