DPCstruct | MC22635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 18.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849BZ85 | 13-143 | ADFDPETGALRRFERGELPAGTEPAGYFGELGAKDPAVFYRGTDGLLLRVDDEIIALDDPDAEVHWEQIDPNRAGLLILTPQRTYRL… |
| A0A0C1AIP7 | 4-91 | LGGVYGDLGDVPVVLYRHQGRLGLRIGSQDIDLDGPVAVQWLPYDQRTTRFVVSVGGAIVADLRYRSLPADMDLGLLLRDVIADAPRR |
| A0A2D5RZP2 | 13-138 | None |
| A0A522BM04 | 3-145 | None |
| A0A1A9LCG2 | 145-266 | None |
| A0A370I1B9 | 1069-1191 | None |
| A0A7X1ZEK1 | 89-221 | None |
| A0A845HPS4 | 155-302 | None |
| A0A7K0D1D6 | 120-230 | None |
| A0A7C4PQ19 | 2-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.