DPCstruct | MC22634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8HLV0 | 2-162 | LLTYFGNDRDIFDDAFYNSAEGGFDIALLSTSSTQVTVRNEETGYTTRLTGTGLAASDDPADLAGTLTGLEISSPTGVIASFTGLNW… |
| A0A561QWP6 | 1-152 | MAKLTTKPLGAAGFDTATDLDVSDLEDYDHLSLSSTLAKFYDDGKNFVSFSGHGFRYTTSGGTLTDVLGGTITKLVVEIHGVQTVSV… |
| A0A0X3T9K9 | 9-171 | None |
| A0A5A9GYE8 | 1-140 | None |
| A0A1Q9AJG3 | 1-152 | None |
| A0A7W3ZH68 | 1-141 | None |
| A0A4V1KIW1 | 3-160 | None |
| A0A7W3W9N7 | 19-153 | None |
| A0A653J4W2 | 2-171 | None |
| A0A0Q4DHC6 | 19-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.