DPCstruct | MC22632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8AMX3 | 309-406 | DVLVTLDFASTVELEATAKQDQYLRPVQWVLTSMGDGDDRSGVVKHLVIISPFEAQALLATVRNNAKTTLHLYAPRSTLGFESLEDL… |
| A0A4V5N538 | 111-208 | KPRPLATIDFARTIETSKSGPFAHMDAYQRPVQWILTAIRNGAIAHMLVISPFEAQELYSRIHASNTVALHLYTPRCNSGFRSLDRL… |
| A0A4S3IYF9 | 210-337 | None |
| L7IQI3 | 987-1093 | None |
| A0A1B7MF40 | 16-103 | None |
| A0A5N5X189 | 31-114 | None |
| A0A1W2TP76 | 58-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.