DPCstruct | MC22630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 63 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6ZR10 | 1-48 | MANPASVYCVKIGGKLRIEKTPQGEQGICVLPNGTEMDEWTLFRRDHS |
| A0A537SNT0 | 15-70 | MAPQSAWALANPASVFCAKSGGKTEIRKGPRGQYGVCRLPDGRVVDEWAYFRAMRA |
| A0A497EJH9 | 39-105 | None |
| A0A7Z9XKU5 | 23-93 | None |
| A0A5E4L8L6 | 87-137 | None |
| A0A5E4LA14 | 133-191 | None |
| A0A1J4UKH0 | 58-115 | None |
| A0A151E8Y2 | 151-206 | None |
| A0A1F7VEW2 | 53-121 | None |
| A0A0B3AGS3 | 19-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.