DPCstruct | MC2263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 320 ± 23 aa |
| Standard deviation of domain lengths | 22.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3JBC4 | 13-328 | SQPGRVGAAAVLEFWVGILTQQNLWYRDKTVLFLMDQICCAAFTHHQEECVQKPLYQQHKNALGYHGDRGLLSSLVGWIAGNATPSF… |
| A0A3Q2YGQ1 | 1-340 | MIIFFSGSQPSHVGAAAVLEFWVGILTQQNLWYRDKTVLFLMDQLCCAAFIHQQEECLLKLLDCLNSVSDRIMLWVTMEIEVWFAWL… |
| A0A2J8MMM6 | 406-732 | None |
| A0A2J8MMK9 | 417-771 | None |
| V5H090 | 3-321 | None |
| A0A2I0TI54 | 253-533 | None |
| A0A4Y2DMX0 | 28-352 | None |
| A0A2S2NNB1 | 610-913 | None |
| A0A6J1RBD6 | 267-593 | None |
| A0A3Q4GGU3 | 10-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.