DPCstruct | MC22628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 153 ± 26 aa |
| Standard deviation of domain lengths | 26.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | PF02615- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0F661 | 65-235 | AVPTTPITMVDMSCSMYSYGMLEVHRLAGRQTFVDAGFDDDGNPTRDPATVEKNRRLMPMGFWKGSGLSIVLDMIATLLSNGESTAT… |
| A0A537SE03 | 25-154 | GRPTTDPAAAIKGMLLPAAGPKGFGLAFVIDLLCGGLSDGAVGAEVRPLYGDPAEPYRCAHFFLAIDAGHFPAGERFAERVRGQATR… |
| A0A016THU2 | 176-327 | None |
| A0A016TIK8 | 27-152 | None |
| A0A3D9E1Y6 | 11-174 | None |
| A0A2P8ZGE7 | 396-588 | None |
| A0A1X6PIB7 | 415-582 | None |
| A0A1A9XB03 | 7-172 | None |
| A0A171JY47 | 190-341 | None |
| A0A3L7UBN3 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.