DPCstruct | MC22627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 172 ± 31 aa |
| Standard deviation of domain lengths | 31.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0LNF5 | 46-215 | DKKWFAGPIRRMSQFMESSRDAVDPLTAEDCAHFIVGIAETAALRDAVICSAVMCMEPDKYVMIACEPYKAASAQFVCDALDPAFND… |
| A0A366KAL5 | 12-169 | TDRDAIDAWKHALDQRCGLDRRQRRLIRETISRDLPCRDAIVCACMDPSLPTESLERMACDPQDDRALRDLARTLDSAFTRGIRLDR… |
| E6JYW1 | 69-233 | None |
| A0A6N9Z5G2 | 28-180 | None |
| A0A261FY66 | 76-307 | None |
| A0A366K9S2 | 13-187 | None |
| A0A4P6DWB8 | 1-198 | None |
| A0A261F2M1 | 197-363 | None |
| A0A087D328 | 29-195 | None |
| A0A7X9BHG7 | 4-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.