DPCstruct | MC22626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497G4X1 | 113-235 | YCHMYFDIWWNGDKYNWYTGSWTLAQFCAGYFDKWWNKDKFNYTNGAEQLVIHCSEYFDKWWDAKKFNWKDASWALARFCSKHFDKW… |
| A0A661TDU4 | 1-109 | MFNWEDSSWALPEYCSKYFRIWWNPNKFNSNDYWKLARHCFEYFETWWNPDMFNWEEESWVLPRYCSKFFHIWWNPEKYSVKDIHFL… |
| A0A661HST0 | 258-365 | None |
| A0A1E7J1W3 | 1-108 | None |
| A0A661KTF2 | 207-314 | None |
| A0A661KRS7 | 51-159 | None |
| A0A497GVZ4 | 301-405 | None |
| A0A661KSV0 | 82-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.