DPCstruct | MC22625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 179 ± 31 aa |
| Standard deviation of domain lengths | 30.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661T8L9 | 1-175 | MAVVGAGHEPGIRRYINDDIDIKALETLPPKGKFSGVLKWLIPAVIVCLIIFGFFQGGVDAGKDMIVWWVAVNGIFAGIGAIIAFGH… |
| A0A7V5ANX2 | 45-219 | KIVAVIGAGHVPGVIENLGRTIDIEPLLTVPPVSPWFKMVGWLLPLFIIGLFVAGFSLSGLKTGMDMLLKWAAVTASFSGLGALLLL… |
| A0A1V5L4I4 | 299-481 | None |
| A0A7J3THP3 | 16-193 | None |
| V7ZP61 | 80-291 | None |
| A0A6A9SZ76 | 2-228 | None |
| A0A2M8BK03 | 486-697 | None |
| A0A1V5XX19 | 2-113 | None |
| A0A2N1TN23 | 185-393 | None |
| A0A7X7P5X3 | 151-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.