DPCstruct | MC22624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 179 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 17.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4PTP3 | 93-286 | GIAILGVGILNGALVVTGFFITWLATLKRYELDCKAAHLRSELQRTDRQLEALFGPLRAITHATEVGWASFVSEHRGFGSGAAAALE… |
| A0A661T5X0 | 5-179 | LSIILTTLVHFSAQYFYDKHLSEKENKKLLKQQKIDYIDKQLTEFYVPLNIQLHRSKRLFLDFKTKHKDKDGILDINQSISKLERAE… |
| V6S3Z6 | 32-194 | None |
| A0A1N7MIC2 | 2-220 | None |
| A0A7S1SNB3 | 2-148 | None |
| A0A0S7BI97 | 8-178 | None |
| A0A383VT57 | 2-171 | None |
| A0A3N5F7K0 | 20-167 | None |
| F0YAS8 | 58-267 | None |
| A0A2E3NMV1 | 16-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.