DPCstruct | MC22623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.92 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0172- PF02556 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661SVK1 | 57-191 | PKFYEAGHDPMHLKSVNVAELFVKVNEIPDDPAKIVHQEMNIFHAHSGYDQERRTIRVGLLLESGMEKERKTAYSMRIELFGEFEAD… |
| A1WBJ0 | 8-136 | FQIQRVYLKDLSLEQPNSPAILLEQEQPSVDIQLGVEATPVVEGIFEVAVTATVQTKIKDKTVFLVEAKQAGIFEIRNVPEDQMGAI… |
| A0A7J4JB08 | 3-137 | None |
| A0A1V5ZGN1 | 3-147 | None |
| A0A399EW41 | 53-176 | None |
| C9RG68 | 17-124 | None |
| A0A3P3XGZ0 | 3-124 | None |
| A0A4R5MCG4 | 3-163 | None |
| A0A256ZUQ3 | 1-112 | None |
| A0A511Z6D2 | 3-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.