DPCstruct | MC22622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 226 ± 35 aa |
| Standard deviation of domain lengths | 34.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8KHD7 | 4-208 | VVLDAETGRQVSVPLGSHHAWTDLEYEKCRHCPLKREEHPECPAAKNLAFVVDDFQLEQSFEKVLVEVVTAERTYRKEVPIQDGLFS… |
| W9TXA6 | 2-203 | AIEYRITLDDEHDFSYRIELDRGYDAETAAQAPKWTRLEHQRCSNCPLSKDDFSHCPAAVDLHRVIEDFQGLPAIQKALVWVRTPER… |
| A0A7C9IMG2 | 2-207 | None |
| A0A1F9RRR8 | 1-291 | None |
| G7Q938 | 2-231 | None |
| A0A1G1C1G3 | 11-198 | None |
| A0A1F9AEI4 | 18-220 | None |
| A0A1G0ZUM0 | 18-239 | None |
| A0A2E7IIX8 | 2-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.