DPCstruct | MC22618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 128 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7EYC2 | 132-252 | KDILGSFQECQNHLRRYGNVNLELVTRIIRDGGPWEDPVLQAVLKAQPASQEIVNKYLSSENPLFFELRARYLIACERIPEAMALIK… |
| A0A4Z2IRK0 | 1-137 | MPQHVPVALWEEFQSSTKLAHSLLQESGSTQLCLLSVLAQQDGVWSNNTLSAIMSNQTPQTEQVHEYLELEGATLLNMRIKHLIKME… |
| A0A4W5PPS6 | 111-243 | None |
| A0A151PG42 | 104-232 | None |
| A0A1S3SMP5 | 64-191 | None |
| D3ZJX1 | 113-241 | None |
| H2S409 | 133-256 | None |
| A0A4W5M429 | 3-134 | None |
| Q9Z2U2 | 115-247 | None |
| A0A3S2NV83 | 138-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.