DPCstruct | MC22614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 525 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.57 |
| Pfam Score | 99.72 |
| Assigned Pfam label(s) | PF07217- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533ISX9 | 24-166 | RPLTPGEAKRVAAAFGEELPARALRFVPGPGRSAFAAMAFRKGNPAITVGRTVYIRADRYRPDLAATPEDIELLVHECTHVVQYRRH… |
| A0A5B8U5V6 | 16-124 | DVQAAIGLAHGGGRPLHEGTAGRLSEVLQDPLHDVRVHDGPEAAMLARAVAARAFTVGNDIFFGAGEYRPGTADGDRLIAHEATHVI… |
| A0A2T6CHJ5 | 5-118 | None |
| A0A833GXS7 | 195-309 | None |
| A0A833M0K9 | 73-205 | None |
| A0A7U4P9K8 | 90-236 | None |
| A0A833GXN6 | 110-228 | None |
| A0A2T4ZVB9 | 105-231 | None |
| A0A840KBA9 | 95-212 | None |
| A0A7K3G854 | 87-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.