DPCstruct | MC22611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2U292 | 1-95 | MGGKTWSKDEERLLWEVIIPQSPAAAYSDDNDNDCLSWDQLADEMNKLSGANARREYTGTSLYEHYYQNIKSGHRSSKAAEFVEKYL… |
| A0A135SQQ2 | 1-98 | MPGKAWSKEEERVFWRSIVPISAKGIGGGSARSWEDLAIIMQREMGPNAKRQYTHLSLVEHYFQNHDKEHFSPFAAPYVREMKSAMA… |
| G9P897 | 1-95 | None |
| A0A3S4C5B5 | 1-96 | None |
| A0A1J7IQV3 | 1-119 | None |
| A0A2S4L2R9 | 1-90 | None |
| A0A5Q3FSA0 | 201-287 | None |
| G2QTC5 | 1-96 | None |
| M7SJK2 | 1-90 | None |
| A0A4R8PZ80 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.