DPCstruct | MC22608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4L3T1 | 1-135 | MFNADGSVRVPGGEGQGKAPPRGAPGSETDSWSRDQIANAGQWLKRPPYDYTPTSFDKYWLPNATLLEEWVRRGIKSVNIPIPGTSS… |
| A0A836P2X5 | 22-179 | SDRNREGDTTGASAQRNGMFNADGSVKVATGTGDAGKGAGDRGPPGSETDTWTRDQIAQGGTWLKRPPYGYTPTSLDKYWMPNQTLL… |
| G7UP33 | 116-256 | None |
| A0A5D8ZF96 | 2-139 | None |
| A0A2N1GLB2 | 238-394 | None |
| A0A0S2FA62 | 417-567 | None |
| A0A4Q1JZ26 | 383-515 | None |
| A0A087MM71 | 308-450 | None |
| A0A3M2I412 | 390-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.