DPCstruct | MC22605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 289 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 37.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q84TJ4 | 123-435 | LVESGSQWDEFIRLLCECLRLAVIYSFPIPAVGSETGFGSLDQCFFGSDVLKCKLEKANWSTVSDIFRVLRNILKRLSQEDNEEIFD… |
| A0A540N7L0 | 1-308 | MCSDSKLSRLCRLDDDFLRPYTFYVFFRGSNWEGFICLLCVCMNLAITVAVSCSSSCSVDGADDLHSGSSRLILVLKPKLENADWSI… |
| A0A1D6QUU4 | 12-282 | None |
| A0A833V4T5 | 94-358 | None |
| A0A1I9LSE6 | 123-435 | None |
| A0A453BPB9 | 9-281 | None |
| A0A453BP84 | 1-284 | None |
| A0A453BP17 | 1-295 | None |
| A0A1D6QUU7 | 125-412 | None |
| A0A1D6QUS9 | 104-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.