DPCstruct | MC22604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 61.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540N1L9 | 3-103 | YKQAPRELLQLMPPLNPMPSQQRYLQYITRRNVGSEWPPLDRALTLDCIIIRFIPNMDREGGCRPIFRIYGQDPFMAADRTPKVLFS… |
| A0A251UKW5 | 134-257 | AFMVAAHTLYRQNFTVETKALDTVYKRASNDLLPGMSPLNPVPSQLRYLQYISRRNADSEWPPADKALTLDCVIMRTIPDFDGKGGC… |
| A0A6P5XNN5 | 135-258 | None |
| M7YNU1 | 128-219 | None |
| A0A5J5V166 | 136-258 | None |
| A0A2K3NF85 | 1-90 | None |
| C7J5K4 | 135-257 | None |
| A0A453PW84 | 26-126 | None |
| A0A1D6HBS1 | 100-200 | None |
| A0A2P2K1Q4 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.