DPCstruct | MC22603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 9.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 63.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7BXG0 | 11-74 | LNVNGKKNRIQVSNTKKPLFFYVNLAKRYMQQHKEVELSALGMAIATVVTIAEILKNNGLALEK |
| A0A5N6NU21 | 202-278 | ITEAVQNISITTTANDPHKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMAIATVVTIAEILKNNGFAVEK |
| A0A811PH90 | 20-93 | None |
| A0A5C7ISI4 | 49-149 | None |
| M8BSE9 | 63-138 | None |
| A0A0K9PXZ9 | 5-84 | None |
| A0A540MPS1 | 48-129 | None |
| A0A287EYU3 | 58-137 | None |
| K7TFA0 | 64-136 | None |
| A0A6J5Y1M9 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.