DPCstruct | MC22602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 186 ± 17 aa |
| Standard deviation of domain lengths | 16.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 71.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540MMW6 | 1-159 | MSDALSIASDLGFSVAAPPIQEELQNLSSSTGEKGDDLIKVLRDLTSVQRKITDLQVELQGRKDDKNVAHLTHASEMERKCETLARI… |
| A0A3P5ZE44 | 21-210 | LSDALSIASDLGYAVAPPPSQEELQTLASSNGERGDDLIRVLRELSSVQRKIADFQVELQGRKDDKNVAHLTHVCEMQKKIDTLSRI… |
| A0A251Q6Q4 | 100-273 | None |
| A0A176WMR6 | 23-239 | None |
| A0A6A6KWA9 | 1-191 | None |
| A0A7I4DZ97 | 23-202 | None |
| A0A072VQR9 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.