DPCstruct | MC22601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 50.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540MLC0 | 1-61 | MGYDYSGYGQSTGKASEQNTYADIEAAYKCLEECYGTKQEDIILYGQSVGSGPTLDLAARL |
| A0A1B0DA52 | 4-72 | PLELKYSTLGWNHPGFGGSTGQPFPDQDQNAIDAVMKFAIHKLGFTPDNILLFGWSIGGYSSIYTAVRY |
| A0A7J7GJB4 | 3-68 | None |
| A0A1D6G2M4 | 5-80 | None |
| A0A0N4VXR0 | 8-78 | None |
| A7AP63 | 5-79 | None |
| A0A2U1LG82 | 1-62 | None |
| A0A3P7HBR9 | 64-124 | None |
| A0A5A7UFM4 | 1-62 | None |
| A0A183A1D8 | 6-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.