DPCstruct | MC2260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 124 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437DBN2 | 9-125 | SSRSDARLLFEILMAGVHFGPTGAFSVADAELSSLRKTKHLDVICEETVPKTLPDVLRLVSGLSRQRGHLHQEDFERTLMTLVYAAQ… |
| A0A3Q2YBE7 | 35-171 | RPSSRHRSMMLFTTRLEWERSFLLGGVELNQDSNIVLLDEEMASMRPGRAFLSRVNNNIPRSLSSMQQMVDVLKSRRKEPMTQDLFE… |
| A0A3Q3FJ60 | 55-188 | None |
| I3LX25 | 46-177 | None |
| A0A6P8UYC9 | 2-104 | None |
| A0A670JDA2 | 152-277 | None |
| G5BS09 | 8-142 | None |
| A0A6P5MAL6 | 32-168 | None |
| A0A3Q1C447 | 21-142 | None |
| A0A3P9LZZ3 | 63-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.