DPCstruct | MC226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329SY53 | 38-122 | MKHVHMVHARVQSDAPLWNASTNTFGSSYYKTADEQFRGLLDTVNTASVEGALMYVQAEGIDVTYQSTPCVRKNKMKYVVFYDIV |
| A0A484DV57 | 21-144 | QSLNNNDTAVTEGSRSSFLKSTLQPFQMVTSLQARVQGDMPQWDTDKQRFVSDYYATFDKKYRALLDTVNMAAVEGALKFVQAECIN… |
| A0A1V9YPZ5 | 823-950 | None |
| M4BY30 | 1-136 | None |
| A0A3F2RDF6 | 1-110 | None |
| M4C0E3 | 87-217 | None |
| W4G8E1 | 1-123 | None |
| A0A3L6VJQ7 | 1-98 | None |
| A0A6A3MFJ6 | 584-711 | None |
| A0A6A3FUA5 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.