DPCstruct | MC22599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 370 ± 77 aa |
| Standard deviation of domain lengths | 76.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 66.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3NNW4 | 1-316 | MDENSVARRLLRPQGEYDRLKEDFVFLYGYHQQETQSIRDEASHARGLLEADFAHLARENLEETAVLRQRNDDLESQLRYAQTQIST… |
| A0A225UZY1 | 10-381 | GHGDLEVLLCFESLDATDLQDLNVLMGGEDADCLPTLRQRVAPVSLAAEVKSIAGQRELAALLGQFPLDRLAERMINSLSFIRRLLA… |
| A0A6A3L078 | 13-288 | None |
| H3H471 | 5-351 | None |
| A0A6G0SDD9 | 1-294 | None |
| A0A662XD43 | 157-672 | None |
| A0A6A3HE91 | 113-577 | None |
| A0A225WJS7 | 1-298 | None |
| A0A225W418 | 156-454 | None |
| H3H559 | 73-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.