DPCstruct | MC22595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 443 |
|---|---|
| Mean domain length (aa) | 123 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF04885- CL0159- CL0005- PF00086- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5MF94 | 123-251 | FWCLFETGACAGPGTCKEVPKVCTSVLQPVCGCDGKTYNNPCLAAVARVNIKSPGACPGGPCTSNLDCAPKEYCKKDIGDCQGKGQC… |
| A0A225US26 | 6-120 | YKGGDCDDQGCPDQYAPVCGSDGVTYSNECNLSIEKCNHPEKNLTMVLDGECPTQRKLMFSEGYQGGDCEDQGCPDDYAPVCGSDGV… |
| A0A6S7GHN6 | 72-188 | None |
| A0A2Z4FK43 | 142-228 | None |
| A0A1D2NDM7 | 209-324 | None |
| P86987 | 6-179 | None |
| A0A7C5J4Q5 | 4-124 | None |
| A0A1G2VKT4 | 779-884 | None |
| A0A7R9KCA8 | 353-426 | None |
| A0A7R9KNR3 | 68-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.