DPCstruct | MC22594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4BQ75 | 95-251 | HQRLTRVVHLWTGSSRWRPTRKALIKIITRRLHFQGLRHRDQRETRPDFRVVSAGTDLVEWKELRHVRETFPTGVQTLYRLKSNSFP… |
| A0A225ULF0 | 10-122 | YQHPHPLLSRLVCLWVGKRRWTQKRAHFKRAIAKASKQRGFTAKAERENNWRVTGGSIGAIISGLEWKRLRRILGLNAWGEQLLFRI… |
| A0A6A3UAI9 | 101-209 | None |
| A0A225WDP5 | 1-141 | None |
| A0A225WY02 | 63-178 | None |
| D0NDX0 | 57-196 | None |
| A0A225W6M8 | 8-111 | None |
| A0A6A3RWY5 | 84-175 | None |
| A0A225WCQ2 | 488-640 | None |
| M4BC18 | 29-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.