DPCstruct | MC22591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 360 ± 43 aa |
| Standard deviation of domain lengths | 42.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1MFK7 | 9-317 | IATLQHDITDHHDQLTALHASAPGRAVVRLVPAKLTQAESLMLSVVGITPGESKAVGVVLERAAGFPAWPIITDPDNAHHALNLVGE… |
| A0A2P8DHQ8 | 20-338 | PPDTGTPGTQPFRVRTYRHPALARPVVRHVADPVAPAEDAALAHLGFGPAQPGSPLTRGHADTALRYPYWALVHDPDHATTALAVTR… |
| A0A1I5GSP1 | 235-635 | None |
| A0A8A9B1M2 | 13-371 | None |
| A0A4U1GWS6 | 1-333 | None |
| A0A7X9VIN9 | 1-340 | None |
| A0A4V3D716 | 319-744 | None |
| A0A562II43 | 7-321 | None |
| A0A3N4SRS1 | 17-354 | None |
| A0A5P1ZX01 | 372-808 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.