DPCstruct | MC2259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18824 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5X905 | 4-76 | EWVKHTWLMLQRLIRDCDYYLGCGNRCAKHLWARDEEAQITEMRKLLAELPDEYKPEWLTSKKIDVYESKMLN |
| A0A0F3HQM2 | 73-146 | QNPFHFDYIMLGRLQEDCNYYLGNGNGDENRLWADNVEAQIAEMKKIWKKFPQGEKPEWLTWEEILEYEKKMKQ |
| A0A3A6JN42 | 882-955 | None |
| A0A564VBC0 | 163-238 | None |
| A0A415ZPJ0 | 2-65 | None |
| I9QHH8 | 69-147 | None |
| A0A1Y4LJT2 | 5-81 | None |
| A0A1C6H9K8 | 93-168 | None |
| A0A1H3YJY2 | 8-80 | None |
| A0A843GQF5 | 74-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.