DPCstruct | MC22585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 164 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6AUY1 | 241-385 | QFTGDRQGAEKLLKRLLDGKADHHQLTMELRPEREDYEAAYTQPLAGQLEKDHLKLWADPRTAIRPQEGQTSLLLTVTSSDRLKKGG… |
| A0A7Y6UIY8 | 8-199 | VVSVVLVAGCDKGDKNKGGESGGGAPAIAQKDGSDGLKDLFAATHAACTGKDFAKGKAIVMGMLPTTAQLKKVFKDDVPAAKLDEVA… |
| A0A2N6B5D8 | 122-264 | None |
| A0A1Q6YFH8 | 29-208 | None |
| A0A2N3W8E2 | 697-852 | None |
| A0A2E7RZ39 | 34-181 | None |
| A1ZIC3 | 2-168 | None |
| A0A520L6T0 | 18-159 | None |
| A0A1M3N7L0 | 64-226 | None |
| A0A368XBE1 | 441-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.