DPCstruct | MC22583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 268 ± 45 aa |
| Standard deviation of domain lengths | 45.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 90.83 |
| Assigned Pfam label(s) | CL0023- PF06798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0YFA4 | 35-316 | RLPRSEKLTPIEMMKLAAGEVAGEKSIKTLAEVIDTLNQEPDITKRFGQKGLGQRDLGRALQLLMETSETNEGRCMFAEDVFKAVER… |
| A0A7Y6UFA7 | 1-272 | TRLEDPKKHSLSLLQKAKLYDGKTLPGFTQDNIKELRKEANREGLDGISPRYIQDKIANALVSDKADGAINPFMVLNELESGLRSHS… |
| A0A7Z9RZL5 | 313-603 | None |
| A0A6A5L5X0 | 751-1013 | None |
| A0A5B8XLM0 | 430-734 | None |
| C2WHN2 | 3-172 | None |
| A0A644Z831 | 1-196 | None |
| A0A139DC19 | 287-560 | None |
| A0A2G9PAR7 | 343-682 | None |
| A0A327Y4V1 | 74-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.