DPCstruct | MC22582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 283 ± 44 aa |
| Standard deviation of domain lengths | 44.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 75.48 |
| Assigned Pfam label(s) | CL0264- CL0125- CL0707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812D175 | 2-228 | SKAAERFCSFLPNDMLAKFCKDQVQKFVPWLNNMHFLGATPDLICQTLHFCTNKKGKFCYLFPQKTLKNYYKHLPKYDKDGDLYSQN… |
| A0A6J0AGN5 | 2-277 | ERLCSYMPEKLFLKTTCYLVVHIFGPDIIKLLSADMNADVVCHTLEFCKQDPGQPFCHLYPLPKEPWKFTLETARQIVKKSPTLTYS… |
| A0A817E5K0 | 1-327 | None |
| A0A2T7NHC7 | 3-326 | None |
| A0A812WFF9 | 117-375 | None |
| A0A7R8ZEN9 | 1-279 | None |
| A0A7M4EVF7 | 11-281 | None |
| V4BLT0 | 58-339 | None |
| A0A820A6N4 | 56-323 | None |
| A0A819H1X5 | 396-715 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.