DPCstruct | MC22580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 330 ± 72 aa |
| Standard deviation of domain lengths | 71.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.34 |
| Pfam Score | 97.12 |
| Assigned Pfam label(s) | PF05649- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3H8F2 | 44-315 | AKDLADLSQNLPTDNPELLEAIKFYNKAGDWQTREKADFSAVKNELAKVETLNTFEDFKNNLTQLVFHSQAPLPFSFSVEPDMKDAI… |
| A0A812CRC5 | 200-501 | RSIDEAIDPCDDFFEYACGRWVKRHPIPDDLSSIDTFTVLRDEVVNILKDLLETSISSTDAVAIQKAKLLYRSCMNECGWPVRNASW… |
| A0A834AFZ1 | 77-478 | None |
| A0A1Y1LYV6 | 7-245 | None |
| A0A368FR80 | 2-235 | None |
| A0A1D8H2S1 | 110-518 | None |
| A0A2P8Z985 | 220-561 | None |
| A0A368F7S5 | 11-219 | None |
| A0A7H1AJ48 | 119-458 | None |
| P0DPD9 | 230-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.