DPCstruct | MC22578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 172 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4UZL7 | 2-163 | NTVLTLTYNQLSTFAGSDNFWNLFDTTFGTQYNRSAAEILRLQWLSGDFSQLPQIEILDNSNLGNANGAYAGSTNKIYLSDSFLANA… |
| B4WVB3 | 132-311 | STVASWSRRASNLSTIAEAVSIATDELTDFRGSADFYDDMTTAFGEGITRTAALDAINSIIEDTADISFEVADIDQYGADAAYAAAT… |
| A0A076H669 | 9-181 | None |
| A0A846DA14 | 8-176 | None |
| A0A845X4G9 | 11-179 | None |
| I4G4M8 | 4-171 | None |
| A0A350Y115 | 6-192 | None |
| Q118G9 | 18-196 | None |
| A0A2W7B2H4 | 20-163 | None |
| A0A6I5PA21 | 42-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.