DPCstruct | MC2257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521BGE2 | 4-104 | LWACKNNKIPADIIPKEKMILMMIDMHYADAYFNREIESDSTLARTNALYKFIFKKYKTDSVQFKHSFDYYAENPEILDNIYEAMID… |
| W6TNS5 | 6-125 | YTAFLFLFVAGCKPGIPSDIIQPDKMALVLHDIHIVDAYITTIPNIDTSRTMAAAYYSGIYKRYEIDSALYGKSMAYYSQHPKVLDG… |
| A0A2P6BZ95 | 9-110 | None |
| A0A660YA12 | 12-140 | None |
| A0A1Y2REX0 | 2-103 | None |
| A0A1F3QSI5 | 1-88 | None |
| A0A2S5A2R8 | 23-153 | None |
| A0A173MM98 | 1-152 | None |
| A0A2S1LMV9 | 7-160 | None |
| A0A2N2WES4 | 57-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.