DPCstruct | MC22569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 148 |
|---|---|
| Mean domain length (aa) | 156 ± 28 aa |
| Standard deviation of domain lengths | 28.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4I0W9 | 3-98 | DGGEIFNLWAKPPVDLYIKIYLFNITNAQAFLAGHEKLQVEQVGPYVYKEIMTHENITFNRNNTMSSTPSHPLVWQKEMSGGRREDD… |
| A0A3S2TPF7 | 154-287 | FVPWLDYIIFRELKIWNGSLSYSYWQRPGVTRLTKVYIFNVTNPHGFLEQGEKPKLVEVGPFVYREDMEKVNIKFHDNDTVTFQHNK… |
| A0A7R9A5L7 | 12-107 | None |
| A0A0Q9W8H1 | 19-170 | None |
| A0A2T7PME0 | 7-177 | None |
| A0A6L5CJN6 | 3-175 | None |
| A0A2H2IB74 | 208-382 | None |
| A0A0N4ZN79 | 44-211 | None |
| A0A6A5D491 | 11-181 | None |
| A0A1D2N655 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.