DPCstruct | MC22568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 226 ± 36 aa |
| Standard deviation of domain lengths | 35.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0020- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812EDZ6 | 687-900 | KSEKTAVNWQGLEASETRAKYLYRSEERFHALQMCGWGNLQDPNGLNKLLEKLQSEGEYERAAAIALFNLQIKRSLAILNTPRNADS… |
| A0A1R2CVV2 | 76-246 | GIGEILEESKSTQKSKGTFTQYSSSERSKCLMFLGWPETPKSLGPITKKLVEDGQFERAAFISVAFGEYQRAVEALKAKKNEHQILY… |
| A0A819AWN6 | 871-1066 | None |
| A0A7M3R0L9 | 2-291 | None |
| M5BT67 | 543-805 | None |
| A0A5B7EM90 | 192-393 | None |
| A0A183CKT9 | 206-434 | None |
| A0A7S4RBD2 | 287-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.