DPCstruct | MC22566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 249 ± 50 aa |
| Standard deviation of domain lengths | 49.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 97.67 |
| Assigned Pfam label(s) | PF11271- PF01130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4DXM8 | 1-184 | VFNVFTGADHLSKLGQMHAWNYQENTGFYDSYCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGP… |
| A0A3S2NZH4 | 452-735 | HFSVLNYRNGIPGGLMDVYRGLDDPADLGRIINWQSSPNLSYWTGANSLCNMLNGTDSGIFQPFINREHPLYVFNSDICRSVELRYQ… |
| H9JVK9 | 131-441 | None |
| A0A2P8XJ36 | 30-279 | None |
| A0A2H2IB74 | 371-659 | None |
| A0A2H2ID01 | 2-270 | None |
| A0A182JIH4 | 16-339 | None |
| A0A0N4ZN79 | 193-547 | None |
| A0A6P4LJE7 | 80-355 | None |
| A0A835P1Y1 | 41-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.