DPCstruct | MC22561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0Z6W9 | 1-73 | MWWEILPSAGIVFAALLAPHGAYWALNKLTHNGKSCARDWRDGPHFEDYTLYLRDIRLTGSEYVPRGLESIPD |
| A0A5E4N874 | 1-74 | MWYEAMPPAIIVYILLNIPDKICSLSNKVFFGNVYKRDIGKPWIQQLYARDWELTGDPYKAQGLESLPDKPTIT |
| A0A0J9XQD3 | 42-112 | None |
| A0A2A2K4L5 | 1-64 | None |
| A0A482VV67 | 1-61 | None |
| A0A0Q9X9M6 | 1-61 | None |
| R4G504 | 1-71 | None |
| A0A336MJ87 | 1-76 | None |
| A0A0L8GC58 | 1-76 | None |
| A0A182UID4 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.