DPCstruct | MC22560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 64 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7KUE3 | 1-70 | MFDQRNLVEDSNNSCRYEKSSWSECSPNGEMSRTDLLKANSDPTCDKSRRIVKKCNKNKQTKATKDKGKR |
| Q9W0S5 | 114-165 | KKCKKACRYEKGSWSECATGQMTRADKLKASSDPSCEATRVIKKNCKPGKSK |
| A0A6I9WQE1 | 52-111 | None |
| T1KG89 | 34-92 | None |
| A0A1A9Z696 | 181-255 | None |
| A0A6I8T391 | 170-226 | None |
| A0A6I8T392 | 113-186 | None |
| A0A6J1WA82 | 41-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.