DPCstruct | MC2256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094D095 | 66-176 | LALVIISLFTVSYACLKLDGSYNRTTRDIGGTLTDNGQKICTFSGKIHAGNKFGSCIEGFSAFIDGSLTWGSYSNRGRERTFRVAID… |
| A0A094FI96 | 85-188 | AFLPAALIAAAPALACLETVGSIDLAGNVQRITAVDNGVTVCDSNRGHRIDQDGHISVTCNAGFVYAVTKDGSMGWYKNPKSSFSFR… |
| A0A093ZX39 | 9-124 | None |
| A0A0C9LYZ1 | 97-223 | None |
| A0A094HSL3 | 2-103 | None |
| A0A093XVD1 | 9-113 | None |
| A0A162N0Q2 | 30-135 | None |
| A0A1Y2GDJ9 | 5-119 | None |
| A0A135SPV3 | 1-98 | None |
| A0A1B8FVC7 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.