DPCstruct | MC22559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 388 ± 44 aa |
| Standard deviation of domain lengths | 43.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4N201 | 23-404 | VSGARVGPPVNVGTVLYGKRDLAKYWTDREAAGLRCREMADQLIPRRIPDGAAFVDYFKLIEVQSSLTVDSQTSRRRIMSAVADAVG… |
| A0A6J1NJ55 | 21-402 | ASPNVGTVLYSAADLKKTQWSKTDIALLQARKYLQNVIPSSRLESTIDEEYLRNLLTYFENCYSTVKREINDPTLRNLMNVALSDAL… |
| A0A482VVB1 | 3-410 | None |
| A0A4C1TWU4 | 12-452 | None |
| T1HMF3 | 38-421 | None |
| B3LXM8 | 122-527 | None |
| A0A1B6JVD7 | 20-374 | None |
| A0A6P7FAG5 | 2-344 | None |
| A0A5E4MF18 | 18-362 | None |
| A0A0L0C7J0 | 231-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.