DPCstruct | MC22555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13967 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6DX04 | 2-108 | AIFRLHDDQILEKCGEDAIHYLSFQRHLIFLLVVVSALSLCIILPVNLSGNLLDKDPYSFGRTTIANLENQNNLIWVHAVLAVVYLS… |
| A0A4D8XUF4 | 36-142 | ALSITEDEILDTCGLDVLIFIRLFKFGINFLLVGSLVGLFVLVPINYLTGDGKQAGHSHSLDAFTITNITKGSDWLWVHCACLYFIS… |
| A0A0S7K564 | 40-148 | None |
| A0A7R9MPZ7 | 2-119 | None |
| A0A7R9AQF5 | 1-94 | None |
| A0A820SX14 | 101-204 | None |
| V9IH12 | 113-218 | None |
| A0A5D2QLD8 | 46-157 | None |
| A0A7J7JUY7 | 1-94 | None |
| A0A481A6Z3 | 13-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.