DPCstruct | MC22553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 356 ± 72 aa |
| Standard deviation of domain lengths | 72.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0154- CL0072- CL0105- CL0366- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8L311 | 23-236 | ARNFQFINSKVRTLPMLADVVVPMRLEPVPVDALWGEVLQEENISIDDSYVECIKMPLLHAGDSTCEELDHFNRIYQCATRNAVTWE… |
| A0A6P6DU82 | 22-419 | RVAPNSCPRVLTREPPGPRRGMEEEKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEILQHLQDIVDFGKNVMKEF… |
| A0A0C2JYE7 | 10-365 | None |
| A0A1A8H8D5 | 11-339 | None |
| A0A146HPD4 | 2-271 | None |
| A0A812IZS4 | 293-653 | None |
| A0A164YC08 | 188-645 | None |
| A0A6G1IGQ1 | 40-404 | None |
| A0A1Q5SUA0 | 10-284 | None |
| A0A1J8QA36 | 10-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.