DPCstruct | MC22552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 144 ± 22 aa |
| Standard deviation of domain lengths | 22.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0C4T2 | 19-172 | REERAKARDHHLSEGVFACQITLNIPGYPKRIKNDCRAIEKFALLFSLRWGSDPFRTDMISNEAGLCWIGFFRGWGSDTQRAKKVAV… |
| E1R6Z7 | 18-180 | VLDARERRVARKQRLVETYNANVIAFTMNIPGPVKNTPCISACFFSGIEALLIYMKEHDLTEVEEYLLSTGPEGYFIFPVTASQWAV… |
| A0A858N6A7 | 7-136 | None |
| A0A3G5HNH6 | 8-142 | None |
| R5LZV7 | 23-182 | None |
| A0A416EKU9 | 31-174 | None |
| A0A432I6B2 | 5-113 | None |
| A0A7V6HCZ1 | 25-155 | None |
| T0PEF3 | 36-185 | None |
| H5UQT6 | 51-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.