DPCstruct | MC22551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 155 ± 52 aa |
| Standard deviation of domain lengths | 51.79 |
| Length coefficient of variation | 0.33 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5MNU7 | 302-546 | FTKSPIEIIDKLKVLCSEAMDETLKHIESCYKVYCEMNHDEVEPFDYEPEILTFSHAYELACKKYGEEFINGYEEYLDETKDDYLDG… |
| A0A2X3VW12 | 5-161 | CFETIEYYDKREVGFDLIDYLEAKTQSDEVKVIIFLAPPFCPRNYTDRDSDVDQALEKMMTEFPEEHFVKRRFSPFLSDSSYLAMRE… |
| A0A1I0GM96 | 65-225 | None |
| A0A136KZ82 | 153-317 | None |
| A0A7X9CSR9 | 89-251 | None |
| A0A235F3Y9 | 2-108 | None |
| A0A511N0A7 | 316-529 | None |
| A0A828ZGQ0 | 25-133 | None |
| A0A645HS55 | 53-189 | None |
| A0A3B9TQ72 | 8-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.