DPCstruct | MC22550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847HVC2 | 128-225 | EEEHRRYEPGKAWRRRGWVVTGRALVTAYERRLYREPEELLGLLPAGLPAPFTTADVAAEGRLPRRLAQQAAYCLHALGLLERVGKA… |
| A0A3D0M7P3 | 2-98 | DLQEFRSLDGWSRDRKKGSHRMERLPLSVYNEVWLKKAEDFDRLLPADLPATFSRADLCKSMKLGQGLKASQTVSALERTGTITLAG… |
| A0A3C1QWC3 | 2-97 | None |
| A0A357ARW8 | 156-267 | None |
| A0A2D8XYM8 | 111-223 | None |
| A0A836VC16 | 18-113 | None |
| R6AIP1 | 207-309 | None |
| A0A812T3Q6 | 285-385 | None |
| A0A812SII5 | 780-879 | None |
| A0A524IVV3 | 60-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.